Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RSTSATDTHHVEMARERSKTVTSFYNQSAIDAAAEKPSVRLTPTMMLYAG RSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFIIGCNPTILHVHELY IRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKH IEDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKK IIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKN AMRATMESHLDTPYNVPDVVITIANNDVDLIIRISDRGGGIAHKDLDRVM DYHFTTAEASTQDPRISPLFGHLDMHSGAQSGPMHGFGFGLPTSRAYAEY LGGSLQLQSLQGIGTDVYLRLRHIDGREESFRI
    • Molecular weight
      69 kDa including tags
    • Amino acids
      30 to 412
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab177577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • [3 methyl 2 oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial
    • [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase
    • BCKD kinase
    • BCKD-kinase
    • BCKD_HUMAN
    • BCKDHKIN
    • Bckdk
    • BCKDKD
    • BDK
    • Branched chain alpha keto acid dehydrogenase kinase
    • Branched chain ketoacid dehydrogenase kinase
    • Branched-chain alpha-ketoacid dehydrogenase kinase
    • mitochondrial
    see all
  • Function
    Catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. Key enzyme that regulate the activity state of the BCKD complex.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the PDK/BCKDK protein kinase family.
    Contains 1 histidine kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab177577.

References

ab177577 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up