Overview

  • Product name
    Recombinant Human Bcl G protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRT RSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVV EKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKV ISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSS KKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTIT DQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKY LKENFSPWIQQHGGWEKILGISHEEVD
    • Amino acids
      1 to 327
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Apoptosis facilitator Bcl 2 like protein 14
    • Apoptosis regulator BCL G
    • Bcl2 L 14
    • BCL2 like 14
    • BCL2 like 14 (apoptosis facilitator)
    • BCL2L14
    • BCLG
    • testicular tissue protein Li 26
    see all
  • Relevance
    Bcl-G is a novel pro-apoptotic member of the Bcl-2 family. The human Bcl-G gene encodes two proteins through alternative mRNA splicing, Bcl-G(L) (long) and Bcl-G(S) (short) consisting of 327 and 252 amino acids in length, respectively. Bcl-G(L) mRNA is expressed widely in adult human tissues, whereas Bcl-G(S) mRNA was found only in testis. Overexpression of Bcl-G(L) or Bcl-G(S) in cells induced apoptosis although Bcl-G(S) was far more potent than Bcl-G(L).
  • Cellular localization
    Isoform 1: Cytoplasm; cytosol. Note: Diffusely distributed throughout the cytosol. Isoform 2: Endomembrane system. Note: Predominantly localized to cytosolic organelles.

Images

  • ab164024 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up