Overview

  • Product name

    Recombinant Human Bcl3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLD PLRGGCDLPAVPGPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPT PLYPMMCPMEHPLSADIAMATRADEDGDTPLHIAVVQGNLPAVHRLVNLF QQGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTA AHLACEHRSPTCLRALLDSAAPGTLDLEARNYDGLTALHVAVNTECQETV QLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGANVNAQMYS GSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDIL RGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPSSSPSQSPP RDPPGFPMAPPNFFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS
    • Molecular weight

      73 kDa including tags

Specifications

Our Abpromise guarantee covers the use of ab152226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • B cell CLL/lymphoma 3
    • B cell leukemia/lymphoma 3
    • B cell lymphoma 3 encoded protein
    • B-cell lymphoma 3 protein
    • Bcl 3
    • BCL 4
    • BCL-3
    • Bcl3
    • BCL3_HUMAN
    • BCL4
    • Chronic lymphatic leukemia protein
    • D19S37
    • Protein Bcl 3
    • Proto-oncogene BCL3
    see all
  • Function

    Contributes to the regulation of transcriptional activation of NF-kappa-B target genes. In the cytoplasm, inhibits the nuclear translocation of the NF-kappa-B p50 subunit. In the nucleus, acts as transcriptional activator that promotes transcription of NF-kappa-B target genes. Contributes to the regulation of cell proliferation.
  • Involvement in disease

    Note=A chromosomal aberration involving BCL3 may be a cause of B-cell chronic lymphocytic leukemia (B-CLL). Translocation t(14;19)(q32;q13.1) with immunoglobulin gene regions.
  • Sequence similarities

    Contains 7 ANK repeats.
  • Post-translational
    modifications

    Polyubiquitinated. Ubiquitination via 'Lys-63'-linked ubiquitin chains is required for nuclear accumulation. Deubiquitinated by CYLD, which acts on 'Lys-63'-linked ubiquitin chains. Deubiquitination by CYLD prevents nuclear accumulation.
    Activated by phosphorylation.
  • Cellular localization

    Nucleus. Cytoplasm. Cytoplasm > perinuclear region. Ubiquitination via 'Lys-63'-linked ubiquitin chains is required for nuclear accumulation.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152226 stained with Coomassie Blue.

References

ab152226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up