Description

  • Product name

    Recombinant human BCMA protein (Active)
    See all BCMA proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.

    Immobilized Human BAFF, Fc Tag at 5 μg/mL (100 μL/well) can bind ab219697 with a linear range of 0.156-2.5 μg/mL.

  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK GTNA
    • Predicted molecular weight

      8 kDa including tags
    • Amino acids

      1 to 54
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain. Accession # NP_001183.2.

Specifications

Our Abpromise guarantee covers the use of ab219697 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 97% PBS, 3% Trehalose

    Lyophilized from 0.22 µm filtered solution.
    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • B cell maturation antigen
    • B cell maturation factor
    • B cell maturation protein
    • B-cell maturation protein
    • BCM
    • BCMA
    • CD269
    • CD269 antigen
    • TNFRSF17
    • TNR17_HUMAN
    • Tumor necrosis factor receptor superfamily member 17
    see all
  • Function

    Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.
  • Tissue specificity

    Expressed in mature B-cells, but not in T-cells or monocytes.
  • Involvement in disease

    Note=A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2.
  • Sequence similarities

    Contains 1 TNFR-Cys repeat.
  • Cellular localization

    Cell membrane. Endomembrane system. Perinuclear Golgi-like structures.
  • Information by UniProt

Images

  • Immobilized Human APRIL, Fc Tag at 5 µg/mL (100 µL/well) can bind Human BCMA, His Tag with a linear range of 2.4-10 ng/mL.
  • Human BCMA, His Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 90%.
  • Anti-Human BCMA MAb (human IgG1) captured on CM5 chip via Anti-Human IgG Fc antibodies surface, can bind Human BCMA, His Tag with an affinity constant of 32.3 nM as determined in a SPR assay (Biacore T200) (Routinely tested).

  • Immobilized Human BCMA, His Tag at 2 µg/mL (100 µL/well) can bind Anti-Human BCMA Mab with a linear range of 0.2-1.6 ng/mL.
  • Immobilized Human BAFF, Fc Tag at 5 µg/mL (100 µL/well) can bind Human BCMA, His Tag with a linear range of 4-125 ng/mL.
  • 293 cells were transfected with anti-BCMA-scFv and RFP tag. 2e5 of the cells were first stained with B. human BCMA / TNFRSF17 protein, His tag �and C. His tag protein control, followed by FITC-conjugated anti-6xHis tag antibody. A. Non-transfected 293 cells and C. His tag protein control were used as negative control. RFP was used to evaluate CAR (anti-BCMA-scFv) expression and FITC was used to evaluate the binding activity of human BCMA / TNFRSF17 protein, His tag .
  • SDS-PAGE analysis of ab219697 under reducing (lane 1) and non-reducing (lane 2) conditions; stained overnight with Coomassie Blue. 

  • Immobilized Human BAFF, Fc Tag at 5 μg/mL (100 μL/well) can bind ab219697 with a linear range of 0.156-2.5 μg/mL.

References

ab219697 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219697.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up