Bioactive grade

Recombinant human BCMA protein (Fc Chimera Active) (Biotin) (ab246079)

Description

  • Product name

    Recombinant human BCMA protein (Fc Chimera Active) (Biotin)
    See all BCMA proteins and peptides
  • Biological activity

    Assay #1: Immobilized Human BAFF, Fc Tag at 5 μg/mL (100 μL/well) can bind ab246079 with a linear range of 0.12-1.95 ng/mL.

    Assay #2: Immobilized Anti-Human BCMA Mab at 2 μg/mL (100 μL/well) can bind ab246079 with a linear range of 0.1-3 ng/mL.

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK GTNA
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      1 to 54
    • Tags

      Avi tag C-Terminus , Fc tag C-Terminus
    • Additional sequence information

      NP_001183.2. Extracellular domain fused to human IgG1 Fc tag at the C-terminal. AviTag sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246079 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.50
    Constituents: 5% Trehalose, 0.61% Tris, 0.75% Glycine

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • B cell maturation antigen
    • B cell maturation factor
    • B cell maturation protein
    • B-cell maturation protein
    • BCM
    • BCMA
    • CD269
    • CD269 antigen
    • TNFRSF17
    • TNR17_HUMAN
    • Tumor necrosis factor receptor superfamily member 17
    see all
  • Function

    Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.
  • Tissue specificity

    Expressed in mature B-cells, but not in T-cells or monocytes.
  • Involvement in disease

    Note=A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2.
  • Sequence similarities

    Contains 1 TNFR-Cys repeat.
  • Cellular localization

    Cell membrane. Endomembrane system. Perinuclear Golgi-like structures.
  • Information by UniProt

Images

  • 293 cells were transfected with anti-BCMA-scFv and RFP tag. 2e5 of the cells were first stained with B. Biotinylated Human BCMA, Fc,Avitag �and C. biotinylated protein control, followed by FITC-conjugated streptavidin. A. Non-transfected 293 cells and C. biotinylated protein control were used as negative control. RFP was used to evaluate CAR (anti-BCMA-scFv) expression and FITC was used to evaluate the binding activity of Biotinylated Human BCMA, Fc,Avitag .
  • SDS-PAGE - Human BCMA protein (Fc Chimera Active) (Biotin) (ab246079).

    The gel was stained overnight with Coomassie Blue.

    As a result of glycosylation, the protein migrates as 40-45 kDa under reducing conditions (shown in image), and 70-85 kDa under non-reducing conditions (not shown).

  • Immobilized Human BAFF, Fc Tag at 5 μg/mL (100 μL/well) can bind ab246079 with a linear range of 0.12-1.95 ng/mL.

  • Immobilized Anti-Human BCMA Mab at 2 μg/mL (100 μL/well) can bind ab246079 with a linear range of 0.1-3 ng/mL.

References

ab246079 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246079.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up