Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MLSATPLYGNVHSWMNSERVRMCGASEDRKILVNDGDASKARLELREENP LNHNVVDASTAHRIDGLAALSMDRTGLIREGLRVPGNIVYSSLCGLGSEK GREAATSTLGGLGFSSERNPEMQFKPNTPETVEASAVSGKPPNGFSAIYK TPPGIQKSAVATAEALGLDRPASDKQSPLNINGASYLRLPWVNPYMEGAT PAIYPFLDSPNKYSLNMYKALLPQQSYSLAQPLYSPVCTNGERFLYLPPP HYVGPHIPSSLASPMRLSTPSASPAIPPLVHCADKSLPWKMGVSPGNPVD SHAYPHIQNSKQPRVPSAKAVTSGLPGDTALLLPPSPRPSPRVHLPTQPA ADTYSEFHKHYARISTSPSVALSKPYMTVSSEFPAARLSNGKYPKAPEGG EGAQPVPGHARKTAVQDRKDGSSPPLLEKQTVTKDVTDKPLDLSSKVVDV DASKADHMKKMAPTVLVHSRAGSGLVLSGSEIPKETLSPPGNGCAIYRSE IISTAPSSWVVPGPSPNEENNGKSMSLKNKALDWAIPQQRSSSCPRMGGT DAVITNVSGSVSSAGRPASASPAPNANADGTKTSRSSVETTPSVIQHVGQ PPATPAKHSSSTSSKGAKASNPEPSFKANENGLPPSSIFLSPNEAFRSPP IPYPRSYLPYPAPEGIAVSPLSLHGKGPVYPHPVLLPNGSLFPGHLAPKP GLPYGLPTGRPEFVTYQDALGLGMVHPMLIPHTPIEITKEEKPERRSRSH ERARYEDPTLRNRFSEILETSSTKLHPDVPTDKNLKPNPNWNQGKTVVKS DKLVYVDLLREEPDAKTDTNVSKPSFAAESVGQSAEPPKPSVEPALQQHR DFIALREELGRISDFHETYTFKQPVFTVSKDSVLAGTNKENLGLPVSTPF LEPPLGSDGPAVTFGKTQEDPKPFCVGSAPPSVDVTPTYTKDGADEAESN DGKVLKPKPSKLAKRIANSAGYVGDRFKCVTTELYADSSQLSREQRALQV SPPT
    • Amino acids

      1 to 1004
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 5830466J11Rik
    • 8430401K06Rik
    • ANOP 2
    • ANOP2
    • BCL 6 co repressor
    • BCL 6 corepressor
    • BCL 6 interacting corepressor
    • BCL-6 corepressor
    • BCL6 co repressor
    • BCL6 corepressor
    • BCL6 interacting corepressor
    • BCoR
    • BCOR_HUMAN
    • FLJ20285
    • FLJ38041
    • KIAA1575
    • MAA 2
    • MAA2
    • MCOPS 2
    • MCOPS2
    • MGC131961
    • MGC71031
    see all
  • Function

    Transcriptional corepressor. May specifically inhibit gene expression when recruited to promoter regions by sequence specific DNA-binding proteins such as BCL6 and MLLT3. This repression may be mediated at least in part by histone deacetylase activities which can associate with this corepressor. Involved in the repression of TFAP2A; impairs binding of BCL6 and KDM2B to TFAP2A promoter regions. Via repression of TFAP2A acts as a negative regulator of osteo-dentiogenic capacity in adult stem cells; the function implies inhibition of methylation on histone H3 'Lys-4' (H3K4me3) and 'Lys-36' (H3K36me2).
  • Tissue specificity

    Ubiquitously expressed.
  • Involvement in disease

    Defects in BCOR are the cause of microphthalmia syndromic type 2 (MCOPS2) [MIM:300166]. Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues (anophthalmia). In many cases, microphthalmia/anophthalmia occurs in association with syndromes that include non-ocular abnormalities. MCOPS2 is a very rare multiple congenital anomaly syndrome characterized by eye anomalies (congenital cataract, microphthalmia, or secondary glaucoma), facial abnormalities (long narrow face, high nasal bridge, pointed nose with cartilages separated at the tip, cleft palate, or submucous cleft palate), cardiac anomalies (atrial septal defect, ventricular septal defect, or floppy mitral valve) and dental abnormalities (canine radiculomegaly, delayed dentition, oligodontia, persistent primary teeth, or variable root length).
  • Sequence similarities

    Belongs to the BCOR family.
    Contains 3 ANK repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab153388 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up