Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGRLDGKVIILTAAAQGIGQAAALAFAREG AKVIATDINESKLQELEKYPGIQTRVLDVTKKKQIDQFANEVERLDVLFN VAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIIN MSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTV DTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESA YVTGNPVIIDGGWSL
    • Molecular weight
      29 kDa including tags
    • Amino acids
      1 to 245
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab103058 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • 3 hydroxybutyrate dehydrogenase type 2
    • 3-hydroxybutyrate dehydrogenase type 2
    • BDH 2
    • BDH2
    • BDH2_HUMAN
    • Dehydrogenase/reductase (SDR family) member 6
    • Dehydrogenase/reductase SDR family member 6
    • DHRS6
    • EFA6R
    • FLJ13261
    • Oxidoreductase ucpA
    • PRO20933
    • R beta hydroxybutyrate dehydrogenase
    • R-beta-hydroxybutyrate dehydrogenase
    • SDR15C1
    • Short chain dehydrogenase/reductase family 15C member 1
    • UCPA OR
    • UNQ6308
    see all
  • Function
    Dehydrogenase that mediates the formation of 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin and associates with LCN2, thereby playing a key role in iron homeostasis and transport. Also acts as a 3-hydroxybutyrate dehydrogenase.
  • Pathway
    Siderophore biosynthesis.
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE (3 µg)

References

ab103058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up