Recombinant human BDNF protein (ab206642)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant human BDNF protein
See all BDNF proteins and peptides -
Biological activity
The activity is determined by the dose-dependent proliferation of C6 cells and is typically between 0.5-1.5 µg/mL. Corresponding to a specific activity of 1 x 103 units/mg.
-
Purity
97 % SDS-PAGE.
Purity is typically 97% as determined by HPLC, Reducing and Non-reducing SDS-PAGE and UV spectroscopy at 280 nm -
Endotoxin level
< 0.050 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIG WRFIRIDTSCVCTLTIKRGR -
Predicted molecular weight
27 kDa including tags -
Amino acids
129 to 247 -
Additional sequence information
Non-glycosylated homodimer, containing two 119 amino acid chains.
-
Specifications
Our Abpromise guarantee covers the use of ab206642 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
Functional Studies
-
Form
Lyophilised -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.
Constituent: 0.1% Trifluoroacetic acid
Lyophilised from a sterile filtered solution containing no additives.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with Sterile water at 100µg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 ºC and avoid repeat freeze thaws.
General Info
-
Alternative names
- Abrineurin
- ANON2
- BDNF
see all -
Function
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. -
Tissue specificity
Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta. -
Involvement in disease
Bulimia nervosa 2
Congenital central hypoventilation syndrome -
Sequence similarities
Belongs to the NGF-beta family. -
Post-translational
modificationsThe propeptide is N-glycosylated and glycosulfated.
Converted into mature BDNF by plasmin (PLG). -
Cellular localization
Secreted. - Information by UniProt
Images
-
Functional analysis of ab206642
-
SDS PAGE analysis of ab206642 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.
-
C6 cells were cultured with 0 to 10 ug/mL Human BDNF. Cell proliferation was measured after 7 days and the linear portion of the curve was used to calculate the ED50.
The ED50 of this lot of ab206642 is 0.5-0.8 ug/mL.
This value is comparable to the expected range of 0.5-1.5 ug/mL.
Datasheets and documents
References
ab206642 has not yet been referenced specifically in any publications.