Description

  • Product name

    Recombinant human BDNF protein
    See all BDNF proteins and peptides
  • Biological activity

    The activity is determined by the dose-dependent proliferation of C6 cells and is typically between 0.5-1.5 µg/mL. Corresponding to a specific activity of 1 x 103 units/mg.

  • Purity

    97 % SDS-PAGE.
    Purity is typically 97% as determined by HPLC, Reducing and Non-reducing SDS-PAGE and UV spectroscopy at 280 nm
  • Endotoxin level

    < 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIG WRFIRIDTSCVCTLTIKRGR
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      129 to 247
    • Additional sequence information

      Non-glycosylated homodimer, containing two 119 amino acid chains.

Specifications

Our Abpromise guarantee covers the use of ab206642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituent: 0.1% Trifluoroacetic acid

    Lyophilised from a sterile filtered solution containing no additives.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with Sterile water at 100µg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 ºC and avoid repeat freeze thaws.

General Info

  • Alternative names

    • Abrineurin
    • ANON2
    • BDNF
    • BDNF_HUMAN
    • Brain Derived Neurotrophic Factor
    • Brain-derived neurotrophic factor
    • BULN2
    • MGC34632
    • Neurotrophin
    see all
  • Function

    During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.
  • Tissue specificity

    Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.
  • Involvement in disease

    Bulimia nervosa 2
    Congenital central hypoventilation syndrome
  • Sequence similarities

    Belongs to the NGF-beta family.
  • Post-translational
    modifications

    The propeptide is N-glycosylated and glycosulfated.
    Converted into mature BDNF by plasmin (PLG).
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Functional analysis of ab206642
  •  SDS PAGE analysis of ab206642 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.

  • C6 cells were cultured with 0 to 10 ug/mL Human BDNF. Cell proliferation was measured after 7 days and the linear portion of the curve was used to calculate the ED50.
    The ED50 of this lot of ab206642 is 0.5-0.8 ug/mL.
    This value is comparable to the expected range of 0.5-1.5 ug/mL.

References

ab206642 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up