Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTA QAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLI GEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDT QLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELED VEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSV ENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELP LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEK GKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK
    • Molecular weight

      78 kDa including tags
    • Amino acids

      1 to 450

Specifications

Our Abpromise guarantee covers the use of ab131770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • APG6
    • ATG 6
    • ATG6
    • ATG6 autophagy related 6 homolog
    • Bcl-2-interacting protein beclin
    • Beclin 1 (coiled coil moesin like BCL2 interacting protein)
    • Beclin 1 autophagy related
    • Beclin-1
    • Beclin1
    • BECN 1
    • Becn1
    • BECN1_HUMAN
    • Coiled coil myosin like BCL2 interacting protein
    • Coiled-coil myosin-like BCL2-interacting protein
    • GT197
    • Protein GT197
    • VPS 30
    • VPS30
    see all
  • Function

    Plays a central role in autophagy (By similarity). May play a role in antiviral host defense. Protects against infection by a neurovirulent strain of Sindbis virus.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the beclin family.
  • Cellular localization

    Golgi apparatus > trans-Golgi network membrane. Interaction with ATG14 promotes translocation to autophagosomes. Expressed in dendrites and cell bodies of cerebellar Purkinje cells.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131770 stained with Coomassie Blue.

References

ab131770 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up