Overview

  • Product name
    Recombinant Human Bestrophin 3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YEKHGHRHSMIRRVKRFLSAHEHPSSPRRRSYRRQTSDSSMFLPRDDLSP ARDLLDVPSRNPPRASPTWKKSCFPEGSPTLHFSMGELSTIRETSQTST
    • Amino acids
      169 to 267
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165512 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BEST 3
    • BEST3
    • BEST3_HUMAN
    • Bestrophin-3
    • Bestrophin3
    • MGC13168
    • MGC40411
    • OTTHUMP00000195114
    • OTTHUMP00000233491
    • Vitelliform macular dystrophy 2 like 3
    • Vitelliform macular dystrophy 2 like protein 3
    • Vitelliform macular dystrophy 2-like protein 3
    • VMD2L3
    see all
  • Function
    Forms calcium-sensitive (By similarity) chloride channels. Permeable to bicarbonate.
  • Tissue specificity
    Present in skeletal muscle and weakly in brain, spinal cord, bone marrow and retina.
  • Sequence similarities
    Belongs to the bestrophin family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab165512 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165512 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165512.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up