Description

  • Product name

    Recombinant Human Bet1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLS IEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYM MLFSLFVFFIIYWIIKLR
    • Amino acids

      1 to 118
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BET1 homolog
    • Bet1p homolog
    • Golgi vesicular membrane trafficking protein p18
    • hbet1
  • Relevance

    The protein encoded by this gene is a homolog of yeast Bet1 protein which is a golgi-associated protein that participates in vesicular transport from the endoplasmic reticulum (ER) to the Golgi apparatus. Studies with the rat homolog suggest that it is localized in the vesicular structures, and may be involved in the docking process of ER-derived vesicles with the cis-Golgi membrane.
  • Cellular localization

    Cell Membrane

Images

  • ab160925 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160925 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160925.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up