Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLS IEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTK
    • Amino acids
      1 to 95
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160926 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BET1 homolog
    • Bet1p homolog
    • Golgi vesicular membrane trafficking protein p18
    • hbet1
  • Relevance
    The protein encoded by this gene is a homolog of yeast Bet1 protein which is a golgi-associated protein that participates in vesicular transport from the endoplasmic reticulum (ER) to the Golgi apparatus. Studies with the rat homolog suggest that it is localized in the vesicular structures, and may be involved in the docking process of ER-derived vesicles with the cis-Golgi membrane.
  • Cellular localization
    Cell Membrane

Images

  • ab160926 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160926 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160926.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up