Recombinant human beta 2 Defensin/BD-2 protein (Active) (ab200271)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
Description
-
Product name
Recombinant human beta 2 Defensin/BD-2 protein (Active)
See all beta 2 Defensin/BD-2 proteins and peptides -
Biological activity
Fully biologically active when compared to standard. Determined by its ability to chemoattract immature human dendritic cells using a concentration range of 10-100 ng/ml.
-
Purity
> 98 % SDS-PAGE.
ab200271 is >98% pure as assessed by SDS-PAGE and HPLC analyses. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP -
Predicted molecular weight
4 kDa -
Amino acids
24 to 64 -
Additional sequence information
This product is for the mature full length protein without the signal peptide.
-
Specifications
Our Abpromise guarantee covers the use of ab200271 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
HPLC
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Previously labelled as beta 2 Defensin.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 99% Phosphate Buffer, 0.75% Sodium chlorideThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
General Info
-
Alternative names
- BD 2
- BD-2
- BD2
see all -
Function
Has antibacterial activity. -
Tissue specificity
Expressed in the skin and respiratory tract. -
Sequence similarities
Belongs to the beta-defensin family. LAP/TAP subfamily. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab200271 has not yet been referenced specifically in any publications.