Bioactive grade

Recombinant human beta 2 Defensin/BD-2 protein (Active) (ab200271)

Description

  • Product name

    Recombinant human beta 2 Defensin/BD-2 protein (Active)
    See all beta 2 Defensin/BD-2 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. Determined by its ability to chemoattract immature human dendritic cells using a concentration range of 10-100 ng/ml.

  • Purity

    > 98 % SDS-PAGE.
    ab200271 is >98% pure as assessed by SDS-PAGE and HPLC analyses.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
    • Predicted molecular weight

      4 kDa
    • Amino acids

      24 to 64
    • Additional sequence information

      This product is for the mature full length protein without the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab200271 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as beta 2 Defensin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.75% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

General Info

  • Alternative names

    • BD 2
    • BD-2
    • BD2
    • beta 2
    • beta 2 Defensin
    • Beta defensin 2
    • Beta defensin 4B
    • Beta-defensin 2
    • Beta-defensin 4A
    • DEF B2
    • DEF B4
    • DEFB 102
    • DEFB 2
    • DEFB 4
    • DEFB102
    • DEFB2
    • DEFB2, formerly
    • DEFB4
    • DEFB4, formerly
    • DEFB4B
    • DEFB4P
    • Defensin
    • Defensin beta 2
    • Defensin, beta 4
    • Defensin, beta 4, pseudogene
    • Defensin, beta 4A
    • Defensin, beta 4B
    • Defensin, beta, 2, formerly
    • Defensin, beta, 4, formerly
    • DFB4A_HUMAN
    • HBD 2
    • hBD-2
    • HBD2
    • mBD-2
    • SAP 1
    • SAP1
    • Skin antimicrobial peptide 1
    • Skin-antimicrobial peptide 1
    see all
  • Function

    Has antibacterial activity.
  • Tissue specificity

    Expressed in the skin and respiratory tract.
  • Sequence similarities

    Belongs to the beta-defensin family. LAP/TAP subfamily.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab200271 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200271.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up