Bioactive grade

Recombinant human beta 2 Defensin/BD-2 protein (Active) (ab243124)

Description

  • Product name

    Recombinant human beta 2 Defensin/BD-2 protein (Active)
    See all beta 2 Defensin/BD-2 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using immature human dendritic cells is in a concentration range of 10-100 ng/ml.

  • Purity

    > 98 % SDS-PAGE.
    Purity >98% as determined by SDS-PAGE and HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
    • Predicted molecular weight

      4 kDa
    • Amino acids

      24 to 64
    • Additional sequence information

      Full-length mature chain lacking the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab243124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.16% Sodium phosphate, 0.75% Sodium chloride

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • BD 2
    • BD-2
    • BD2
    • beta 2
    • beta 2 Defensin
    • Beta defensin 2
    • Beta defensin 4B
    • Beta-defensin 2
    • Beta-defensin 4A
    • DEF B2
    • DEF B4
    • DEFB 102
    • DEFB 2
    • DEFB 4
    • DEFB102
    • DEFB2
    • DEFB2, formerly
    • DEFB4
    • DEFB4, formerly
    • DEFB4B
    • DEFB4P
    • Defensin
    • Defensin beta 2
    • Defensin, beta 4
    • Defensin, beta 4, pseudogene
    • Defensin, beta 4A
    • Defensin, beta 4B
    • Defensin, beta, 2, formerly
    • Defensin, beta, 4, formerly
    • DFB4A_HUMAN
    • HBD 2
    • hBD-2
    • HBD2
    • mBD-2
    • SAP 1
    • SAP1
    • Skin antimicrobial peptide 1
    • Skin-antimicrobial peptide 1
    see all
  • Function

    Has antibacterial activity.
  • Tissue specificity

    Expressed in the skin and respiratory tract.
  • Sequence similarities

    Belongs to the beta-defensin family. LAP/TAP subfamily.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS Page analysis of ab243124

References

ab243124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up