Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQR I
    • Molecular weight

      6 kDa
    • Amino acids

      28 to 78
    • Additional sequence information

      Mature protein without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab217455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Purity

    > 98 % SDS-PAGE.
    assessed also by HPLC
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Lyophilised from a sterile filtered solution. Centrifuge the vial prior to opening. Reconstitute in Water to a concentration of 0.1 - 1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20C to -80C

General Info

  • Alternative names

    • BD5
    • Beta defensin 105 precursor
    • DEFB105
    • DEFB5
    • Defensin beta 105
    see all
  • Relevance

    Defensins (a and ß) are cationic peptides with a broad spectrum of antimicrobial activity that comprise an important arm of the innate immune system. The a-defensins are distinguished from the ß-defensins by the pairing of their three disulfide bonds. To date, six human ß-defensins have been identified; BD-1, BD-2, BD-3, BD-4, BD-5 and BD-6. ß-defensins are expressed on some leukocytes and at epithelial surfaces. In addition to their direct antimicrobial activities, they can act as chemoattractants towards immature dendritic cells and memory T cells. The ß-defensin proteins are expressed as the C-terminal portion of precursors and are released by proteolytic cleavage of a signal sequence and in some cases, a propeptide sequence. ß-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds.
  • Cellular localization

    Secreted

References

ab217455 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217455.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up