Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGI VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFT TTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIG NERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSG GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLST FQQMWISKQEYDESGPSIVHRKCF
    • Molecular weight
      35 kDa including tags
    • Amino acids
      102 to 375
    • Tags
      His tag N-Terminus
    • Additional sequence information
      N-terminal 6xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab240844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names
    • A26C1A
    • A26C1B
    • ACTB
    • ACTB_HUMAN
    • Actin beta
    • Actin cytoplasmic 1
    • Actin, cytoplasmic 1, N-terminally processed
    • Actx
    • b actin
    • Beta cytoskeletal actin
    • Beta-actin
    • BRWS1
    • E430023M04Rik
    • MGC128179
    • PS1TP5 binding protein 1
    • PS1TP5BP1
    see all
  • Function
    Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
  • Involvement in disease
    Defects in ACTB are a cause of dystonia juvenile-onset (DYTJ) [MIM:607371]. DYTJ is a form of dystonia with juvenile onset. Dystonia is defined by the presence of sustained involuntary muscle contraction, often leading to abnormal postures. DYTJ patients manifest progressive, generalized, dopa-unresponsive dystonia, developmental malformations and sensory hearing loss.
  • Sequence similarities
    Belongs to the actin family.
  • Post-translational
    modifications
    ISGylated.
  • Cellular localization
    Cytoplasm > cytoskeleton. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab240844.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab240844 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) beta Actin.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab240844 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) beta Actin.

References

ab240844 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab240844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up