Description

  • Product name

    Recombinant Human Beta crystallin S protein
  • Purity

    > 95 % SDS-PAGE.
    ab111642 is purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMSKTGTKITFYEDKNFQGRRYDCDCD CADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGL NDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMRE IHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRI VE
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      1 to 178
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 10% Glycerol, 0.02% DTT, 0.58% Sodium chloride
    Note: Contains 89% Tris-HCl buffer.

General Info

  • Alternative names

    • AI327013
    • Beta-crystallin S
    • CRBS_HUMAN
    • CRYG8
    • crygs
    • Crystallin, gamma 8
    • Crystallin, gamma polypeptide 8
    • Crystallin, gamma S
    • CTRCT20
    • Gamma crystallin S
    • Gamma S crystallin
    • Gamma-crystallin S
    • Gamma-S-crystallin
    • Opacity due to poor secondary fiber cell junction; recessive nuclear cataract
    • Opj
    • rncat
    see all
  • Function

    Crystallins are the dominant structural components of the vertebrate eye lens.
  • Sequence similarities

    Belongs to the beta/gamma-crystallin family.
    Contains 4 beta/gamma crystallin 'Greek key' domains.
  • Domain

    Has a two-domain beta-structure, folded into four very similar Greek key motifs.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab111642 (3 µg)

References

ab111642 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up