Description

  • Product name

    Recombinant Human beta Sarcoglycan protein
    See all beta Sarcoglycan proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSWAVIRIGPNGCDSMEFHESGLLRFKQV SDMGVIHPLYKSTVGGRRNENLVITGNNQPIVFQQGTTKLSVENNKTSIT SDIGMQFFDPRTQNILFSTDYETHEFHLPSGVKSLNVQKASTERITSNAT SDLNIKVDGRAIVRGNEGVFIMGKTIEFHMGGNMELKAENSIILNGSVMV STTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQVTSQNMGCQISDNP CGNTH
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      87 to 318
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Extracellular domain (NP_000223).

Specifications

Our Abpromise guarantee covers the use of ab202169 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • 43 kDa dystrophin associated glycoprotein
    • 43 kDa dystrophin-associated glycoprotein
    • 43DAG
    • A3b
    • Beta SG
    • Beta-sarcoglycan
    • Beta-SG
    • dystrophin-associated glycoprotein, 43-kD
    • LGMD2E
    • Limb girdle muscular dystrophy 2E (non linked families)
    • Sarcoglycan beta
    • sarcoglycan, beta (43kDa dystrophin-associated glycoprotein)
    • SGC
    • SGCB
    • SGCB_HUMAN
    see all
  • Function

    Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.
  • Tissue specificity

    Highest expression in heart and skeletal muscle. Low expression in brain, kidney, placenta, pancreas and lung. High expression in fetal brain. Also found in fetal lung, kidney and liver.
  • Involvement in disease

    Limb-girdle muscular dystrophy 2E
  • Sequence similarities

    Belongs to the sarcoglycan beta/delta/gamma/zeta family.
  • Post-translational
    modifications

    Disulfide bonds are present.
  • Cellular localization

    Cell membrane, sarcolemma. Cytoplasm, cytoskeleton.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab202169.

References

ab202169 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202169.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up