Overview

  • Product name

    Recombinant Human Beta TRCP/HOS protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTA FQNSSEREDCNNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLASTAM KTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSESDQV EFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYL DAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQ YLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRS ETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQ YDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCS KDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKV WNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLR VLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRT LVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTY TYISR
    • Molecular weight

      95 kDa including tags
    • Amino acids

      1 to 605

Specifications

Our Abpromise guarantee covers the use of ab132456 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best used within three months from the date of receipt.

     This product was previously labelled as Beta TRCP

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Beta transducin repeat containing E3 ubiquitin protein ligase
    • beta TrCP1
    • beta-transducin repeat containing
    • BETA-TRCP
    • betaTrCP
    • btrC
    • bTrCP
    • bTrCP1
    • E3RSIkappaB
    • F box and WD repeat protein 1B
    • F box and WD repeats protein beta TrCP
    • F-box and WD repeats protein beta-TrCP
    • F-box/WD repeat protein 1A
    • F-box/WD repeat-containing protein 1A
    • FBW1A
    • FBW1A_HUMAN
    • FBXW1
    • FBXW1A
    • FWD1
    • HOS
    • mKIAA4123
    • pIkappaBalpha-E3 receptor subunit
    • Slimb
    see all
  • Function

    Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes and binds to phosphorylated target proteins. SCF(BTRC) mediates the ubiquitination of CTNNB1 and participates in Wnt signaling. SCF(BTRC) mediates the ubiquitination of NFKBIA, NFKBIB and NFKBIE; the degradation frees the associated NFKB1 to translocate into the nucleus and to activate transcription. Ubiquitination of NFKBIA occurs at 'Lys-21' and 'Lys-22'. SCF(BTRC) mediates the ubiquitination of phosphorylated NFKB1/nuclear factor NF-kappa-B p105 subunit, ATF4, SMAD3, SMAD4, CDC25A, DLG1, FBXO5 and probably NFKB2. SCF(BTRC) mediates the ubiquitination of phosphorylated SNAI1. May be involved in ubiquitination and subsequent proteasomal degradation through a DBB1-CUL4 E3 ubiquitin-protein ligase. Required for activation of NFKB-mediated transcription by IL1B, MAP3K14, MAP3K1, IKBKB and TNF. Required for proteolytic processing of GLI3.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 F-box domain.
    Contains 7 WD repeats.
  • Domain

    The N-terminal D domain mediates homodimerization.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab132456 on a 12.5% gel stained with Coomassie Blue.

References

ab132456 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132456.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up