Overview

  • Product name

    Recombinant Human BEX3 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGM GGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLM P
    • Molecular weight

      38 kDa including tags
    • Amino acids

      11 to 111

Specifications

Our Abpromise guarantee covers the use of ab132232 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.

    Previously labelled as NADE.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Bex
    • BEX3
    • BEX3_HUMAN
    • Brain expressed X linked 3 (mouse) homolog
    • brain expressed, X-linked 3
    • Brain-expressed X-linked gene 3
    • Brain-expressed X-linked protein 3
    • DXS6984E
    • HGR74
    • NADE
    • Nerve growth factor receptor (TNFRSF16) associated protein 1
    • Nerve growth factor receptor associated protein 1
    • Nerve growth factor receptor-associated protein 1
    • NGFR-associated protein 1
    • NGFRAP1
    • Ovarian granulosa cell 13.0 kDa protein HGR74
    • Ovarian granulosa cell protein
    • ovarian granulosa cell protein (13kD)
    • p75NTR associated cell death executor
    • p75NTR-associated cell death executor
    • Protein BEX3
    see all
  • Function

    May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death (By similarity). May play an important role in the pathogenesis of neurogenetic diseases.
  • Tissue specificity

    Found in ovarian granulosa cells, testis, prostate and seminal vesicle tissue. High levels also detected in liver.
  • Sequence similarities

    Belongs to the BEX family.
  • Domain

    The nuclear export signal is required for export from the nucleus and the interactions with itself and p75NTR/NGFR.
  • Post-translational
    modifications

    Ubiquitinated. Degraded by the proteasome.
  • Cellular localization

    Nucleus. Cytoplasm. Shuttles between the cytoplasm and the nucleus. Associates with replicating mitochondria.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132232.

References

ab132232 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132232.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up