Description

  • Product name

    Recombinant Human BFAR protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCG HSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRDAIEKLFPDAIR LRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQMGGGFFSGVLT ALTGVAVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASL YRERFLSERVNGRLLLTLTEEEFSKTPYTIENSSHRRAILMELERVKALG VKPPQNLWEYKAVNPGRSLFLLYALKSSPRLSLLYLYLFDYTDTFLPFIH TICPLQEDSSGEDIVTKLLDLKEPTWKQWREFLVKYSFLPYQLIAEFAWD WLEVHYWTSRFLIINAMLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKV STQGLFVAMFWPLIPQFVCNCLFYWALYFNPIINIDLVVKELRRLETQVL
    • Amino acids

      1 to 450
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162491 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BAR
    • Bfar
    • BFAR_HUMAN
    • Bifunctional apoptosis inhibitor
    • Bifunctional apoptosis regulator
    • RING finger protein 47
    • RNF47
    see all
  • Function

    Apoptosis regulator. Has anti-apoptotic activity, both for apoptosis triggered via death-receptors and via mitochondrial factors.
  • Tissue specificity

    Expressed highly in brain, moderately in small intestine, weakly in testes and only faintly in liver and skeletal muscle. Not expressed in heart, kidney, lung and spleen.
  • Sequence similarities

    Contains 1 RING-type zinc finger.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162491 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162491 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162491.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up