Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK NLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP KS
    • Molecular weight

      18 kDa
    • Amino acids

      1 to 152

Specifications

Our Abpromise guarantee covers the use of ab151841 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab151841 has purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. 0.2 µM filtered.
  • Form

    Liquid
  • Additional notes

    Previously labelled as Bcl2A1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.40
    Constituents: 89% Phosphate Buffer, 0.02% DTT, 0.03% EDTA, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • ACC 1
    • ACC 2
    • B2LA1_HUMAN
    • Bcl 2 related protein A1
    • Bcl-2-like protein 5
    • Bcl-2-related protein A1
    • BCL2 related protein A1
    • Bcl2-L-5
    • BCL2A1
    • BCL2L5
    • BFL1
    • GRS
    • HBPA1
    • Hematopoietic BCL2 related protein A1
    • Hemopoietic specific early response protein
    • Hemopoietic-specific early response protein
    • Protein BFL 1
    • Protein BFL-1
    • Protein GRS
    see all
  • Function

    Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection.
  • Tissue specificity

    Seems to be restricted to the hematopoietic compartment. Expressed in peripheral blood, spleen, and bone marrow, at moderate levels in lung, small intestine and testis, at a minimal levels in other tissues. Also found in vascular smooth muscle cells and hematopoietic malignancies.
  • Sequence similarities

    Belongs to the Bcl-2 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab151841 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151841.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up