Overview

  • Product name

    Recombinant Human BHC80 / PHF21A protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      KQTVKSHTETDEKQTESRTITPPAAPKPKREENPQKLAFMVSLGLVTHDH LEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVTYLNSTMHPGTRKRA
    • Amino acids

      331 to 430
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BHC80a
    • BM-006
    • BRAF35-HDAC complex protein BHC80
    • BRAF35/HDAC2 complex (80 kDa)
    • KIAA1696
    • PF21A_HUMAN
    • PHD finger protein 21A
    • PHF21A
    see all
  • Function

    Component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it may act as a scaffold. Inhibits KDM1A-mediated demethylation of 'Lys-4' of histone H3 in vitro, suggesting a role in demethylation regulation.
  • Tissue specificity

    Highly expressed in brain. Expressed at much lower level in other tissues.
  • Sequence similarities

    Contains 1 A.T hook DNA-binding domain.
    Contains 1 PHD-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab162507 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162507 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162507.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up