Overview

  • Product name

    Recombinant Human BIG1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      EVLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGT IEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPS P
    • Amino acids

      311 to 411
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161048 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ADP ribosylation factor guanine nucleotide exchange factor 1(brefeldin A inhibited)
    • ADP-ribosylation factor guanine nucleotide exchange factor 1
    • ARF GEP1
    • ARFGEF1
    • ARFGEP1
    • Brefeldin A inhibited GEP 1
    • Brefeldin A inhibited guanine nucleotide exchange protein 1
    • P200
    • p200 ARF guanine nucleotide exchange factor
    see all
  • Relevance

    BIG1 is a brefeldin A-inhibited guanine nucleotide exchange protein (GEP) that activates ADP-ribosylation factor (ARF) GTPases and functions in vesicle formation from Golgi membranes.
  • Cellular localization

    Cytoplasmic, Golgi Apparatus and Nuclear

Images

  • ab161048 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161048 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161048.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up