Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQH LLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVI CPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILT PLIKKSYFPKILTFFVGLAIGTLFSNAIFQLIPEAFGFDPKVDSYVEKAV AVFGGFYLLFFFERMLKMLLKTYGQNGHTHFGNDNFGPQEKTHQPKALPA INGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCLKGPKLSEI GTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELG DFVILLNAGMSTRQALLFNFLSACSCYVGLAFGILVGNNFAPNIIFALAG GMFLYISLADMFPEMNDMLREKVTGRKTDFTFFMIQNAGMLTGFTAILLI TLYAGEIELE
    • Amino acids
      1 to 460
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4933419D20Rik
    • AA986696
    • BCG induced integral membrane protein 103
    • BCG induced integral membrane protein BIGMo-103 (Up-regulated by BCG-CWS) (Hypothetical protein)
    • LIV-1 subfamily of ZIP zinc transporter 6
    • LZT Hs6
    • MGC108852
    • PP3105
    • SLC39A8
    • Solute carrier family 39 (zinc transporter), member 8
    • Solute carrier family 39 (zinc transporter), member 8 (SLC39A8)
    • Solute carrier family 39 member 8
    • zinc transporter ZIP8
    • ZIP8
    • Zrt- and Irt-like protein 8
    see all
  • Relevance
    BIGM103 belongs to a subfamily of proteins that show structural characteristics to zinc transporters. Zinc is an essential element. It acts as a cofactor for hundreds of enzymes and is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation.
  • Cellular localization
    Membrane; Multi-pass membrane protein

Images

  • ab163783 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163783 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up