Overview

  • Product name

    Recombinant Human Bik protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      EDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMH SLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQV
    • Molecular weight

      37 kDa including tags
    • Amino acids

      37 to 136

Specifications

Our Abpromise guarantee covers the use of ab152233 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Apoptosis inducer NBK
    • BBC1
    • Bcl-2-interacting killer
    • BCL2 interacting killer
    • bhikhari
    • BIK
    • Bik-like killer protein
    • BIK_HUMAN
    • BIP 1
    • BiP1
    • BP 4
    • BP4
    • cb 60
    • NBK
    see all
  • Function

    Accelerates programmed cell death. Binding to the apoptosis repressors Bcl-X(L), BHRF1, Bcl-2 or its adenovirus homolog E1B 19k protein suppresses this death-promoting activity. Does not interact with BAX.
  • Domain

    Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.
  • Cellular localization

    Endomembrane system. Around the nuclear envelope, and in cytoplasmic membranes.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152233 stained with Coomassie Blue.

References

ab152233 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152233.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up