Recombinant Human Bile Acid Receptor NR1H4 protein (ab81918)

Description

  • Product name

    Recombinant Human Bile Acid Receptor NR1H4 protein
    See all Bile Acid Receptor NR1H4 proteins and peptides
  • Biological activity

    1 unit equals 1 nanogram purified protein.
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human

Specifications

Our Abpromise guarantee covers the use of ab81918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    EMSA

  • Form

    Liquid
  • Additional notes

    1 unit equals 1 nanogram purified protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.75% Potassium chloride, 0.0154% DTT, 0.316% Tris HCl, 0.00584% EDTA, 20% Glycerol

General Info

  • Alternative names

    • BAR
    • Bile acid receptor
    • Farnesoid X activated receptor
    • Farnesoid X receptor
    • Farnesoid X-activated receptor
    • Farnesol receptor HRR 1
    • Farnesol receptor HRR-1
    • Farnesol receptor HRR1
    • FXR
    • HRR 1
    • HRR1
    • NR1H4
    • NR1H4_HUMAN
    • Nuclear receptor subfamily 1 group H member 4
    • Retinoid X receptor interacting protein 14
    • Retinoid X receptor-interacting protein 14
    • RIP 14
    • RIP14
    • RXR interacting protein 14
    • RXR-interacting protein 14
    see all
  • Function

    Ligand-activated transcription factor. Receptor for bile acids such as chenodeoxycholic acid, lithocholic acid and deoxycholic acid. Represses the transcription of the cholesterol 7-alpha-hydroxylase gene (CYP7A1) through the induction of NR0B2 or FGF19 expression, via two distinct mechanisms. Activates the intestinal bile acid-binding protein (IBABP). Activates the transcription of bile salt export pump ABCB11 by directly recruiting histone methyltransferase CARM1 to this locus.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab81918 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Question
Answer

Merci pour la confirmation.

Comme convenu j'ai demandé à notre service comptabilité de mettre en place un avoir référence CN.

Votre référence CN est ******.

Voici les manières dont vous pouvez utiliser cette référence CN:
(1) la faire valoir contre la facture originale si celle-ci n'as pas encore été payée
(2) la faire valoir contre une prochaine facture
(3) obtenir un remboursement de la somme entière si vous n'avez pas de factures actuellement en cours avec Abcam

Si vous souhaitez recevoir un remboursement au lieu d'un avoir, veuillez demander à votre service de gestion de prendre contact avec notre département comptabilité afin que nous puissions recueillir les informations nécessaires pour cette restitution. Notre service comptabilité peut être contacté par courriel à l'adresse creditcontrol@abcam.com ou par téléphone en utilisant le lien « Contactez-nous » dans le coin en haut à droite de notre site internet. Veuillez communiquer votre numéro d'avoir lorsque vous contactez notre service comptabilité.

Vous recevrez également la référence complète de la note de crédit par courriel ou par voie postale; cette référence commençant par les lettres CGB.

J'espère que cette expérience ne vous empêchera pas de commander à nouveau l'un de nos produits.

L'équipe technique reste à votre disposition pour plus de conseils.

Bonne continuation dans votre recherche.

Read More

Answer

Merci pour votre réponse.

Je comprends vos interrogations concernantla qualité dece produit et je serais absolument d'accord pour éditer un remboursement.

Cependant, sachez que si le nouveau lot que je vous propose de recevoir gratuitementne convient toujours pas vous pourrez bénéficier d'un remboursement sur la commande originale.

Merci dem'indiquer si je dois effectuer directement le remboursement ou si vous souhaitez tester le dernier lot de ab81918.

Read More

Answer

Merci pour votre patience.

Le laboratoire qui produit la protéine ab81918'Bile Acid Receptor NR1H4 protein (His tag)' vient de m'informer et confirmer que le nouveau lot correspond bienà la protéine humaine (U68233) :
MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYS
PGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKC
KNGGNCVMDMYMRRKCQECRLRKCKEMGMLAECLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSCRE
KTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVE
AMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLL
DVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ

Je serai ravi de vous envoyer, si vous le désirez,ce nouveau lot en remplacement de celui que vous avez reçu. Est-ce que cette solution vous conviendrait? Alternativement je peux vous proposer d'éditer un avoir / remboursement contre la commande originale.

Merci de m'indiquer la solution qui vous conviendrait le mieux.

Read More

Question
Answer

Merci de nous avoir contactés et désolé pour le délai de ma réponse, j'attendais une réponse du laboratoire.

J'ai été informé que des tests de caractérisation vont être à nouveau effectués afin de vérifier l'authenticité de la protéine 'Bile Acid Receptor NR1H4' humaine (His tag) ab81918.

La protéine a été produite à partir de la séquence suivante :

Human Bile Acid Receptor NR1H4 :
MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVE
PYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETE
VAEMPVTKKPRMGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAV
YKCKNGGNCVMDMYMRRKCQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQ
HADQTVNEDSEGRDLRQVTSTTKSCREKTELTPDQQTLLHFIMDSYNKQRMPQEITNK
ILKEEFSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFL
RSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAI
VILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHH
HAEMLMSWRVNDHKFTPLLCEIWDVQ

J'espère que ces informations vous seront utiles. Je vous contacterai de nouveau une fois que j'aurai reçu les résultats de QC.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up