Question (38262) | Recombinant Human Bile Acid Receptor NR1H4 protein (ab81918)

Go to datasheet (ab81918)

Question

Mass Spec analysis suggests that ab81918 is the rat protein, not human.

Answer

Merci de nous avoir contactés et désolé pour le délai de ma réponse, j'attendais une réponse du laboratoire.

J'ai été informé que des tests de caractérisation vont être à nouveau effectués afin de vérifier l'authenticité de la protéine 'Bile Acid Receptor NR1H4' humaine (His tag) ab81918.

La protéine a été produite à partir de la séquence suivante :

Human Bile Acid Receptor NR1H4 :
MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVE
PYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETE
VAEMPVTKKPRMGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAV
YKCKNGGNCVMDMYMRRKCQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQ
HADQTVNEDSEGRDLRQVTSTTKSCREKTELTPDQQTLLHFIMDSYNKQRMPQEITNK
ILKEEFSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFL
RSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAI
VILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHH
HAEMLMSWRVNDHKFTPLLCEIWDVQ

J'espère que ces informations vous seront utiles. Je vous contacterai de nouveau une fois que j'aurai reçu les résultats de QC.

Sign up