Description

  • Product name

    Recombinant Human Bim protein
    See all Bim proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSC DKSTQTPSPPCQAFNHYLSAMVVILEDIGDLSLCFGFIFTGLDLYGHHHS QDTEQLNHKDFS
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      1 to 112

Specifications

Our Abpromise guarantee covers the use of ab112387 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

    Other

  • Form

    Liquid
  • Additional notes

    Best to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names

    • BCL2 like 11
    • B2L11_HUMAN
    • BAM
    • Bcl 2 interacting protein Bim
    • Bcl 2 related ovarian death agonist
    • Bcl-2-like protein 11
    • BCL2 interacting mediator of cell death
    • BCL2 like 11 (apoptosis facilitator)
    • BCL2 like protein 11
    • Bcl2-interacting mediator of cell death
    • Bcl2-L-11
    • Bcl2l11
    • BIM
    • BIM alpha6
    • BIM beta6
    • BIM beta7
    • BimEL
    • BimL
    • BOD
    see all
  • Function

    Induces apoptosis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than the isoforms BimEL, BimL and BimS. Isoform Bim-gamma induces apoptosis.
  • Tissue specificity

    Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are ubiquitously expressed with a tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in spleen, prostate, testis, heart, liver and kidney.
  • Sequence similarities

    Belongs to the Bcl-2 family.
  • Domain

    The BH3 motif is required for Bcl-2 binding and cytotoxicity.
  • Cellular localization

    Mitochondrion and Endomembrane system. Associated with intracytoplasmic membranes.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab112387. Stained with Coomassie Blue

References

ab112387 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

This product is Human Bim full-length ORF ( NP_996885.1, 1 a.a. - 112 a.a.) recombinant protein with a proprietary tag. Please contact our scientific support group for more information regarding this tag. We have not done any tests for enzymatic activity yet so we are not sure if the protein is active. We are happy to provide our protocols for ELISA on the protocols tab of the datasheet.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up