Overview

  • Product name

    Recombinant Human BIN2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNF YQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELK AIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYD SARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEELPILYN SRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLEKQHSN
    • Molecular weight

      30 kDa including tags
    • Amino acids

      1 to 244
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152048 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab152048 is greater than 95%, as determined by reducing SDS-PAGE. It was lyophilized from an 0.2 µM filtered solution.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names

    • BIN2
    • BIN2_HUMAN
    • BRAP 1
    • Breast cancer associated protein BRAP1
    • Breast cancer-associated protein 1
    • Bridging integrator 2
    see all
  • Tissue specificity

    Highest level expression seen in spleen and peripheral blood leukocytes and is also expressed at high levels in thymus, colon and placenta, suggesting preferential expression in hematopoietic tissues.
  • Sequence similarities

    Contains 1 BAR domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab152048 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152048.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up