Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPP PPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSL VTGREGYVPSNFVARVESLEMERWFFRSQGRKEAERQLLAPINKAGSFLI RESETNKGAFSLSVKDVTTQGELIKHYKIRCLDEGGYYISPRITFPSLQA LVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQSLRLVRKLGSG QFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKALQHERLVRLY AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY IERMNSIHRDLRAANILVSEALCCKIADFGLARIIDSEYTAQEGAKFPIK WTAPEAIHFGVFTIKADVWSFGVLLMEVVTYGRVPYPGMSNPEVIRNLER GYRMPRPDTCPPELYRGVIAECWRSRPEERPTFEFLQSVLEDFYTATERQ YELQPLE
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 505
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab172848 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as an 0.2 µM filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.24% Tris, 2.9% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • B lymphocyte kinase
    • B lymphoid tyrosine kinase
    • Blk
    • BLK nonreceptor tyrosine kinase
    • BLK_HUMAN
    • EC 2.7.10.2
    • MGC 10442
    • MGC10442
    • MODY 11
    • MODY11
    • P55 BLK
    • p55-BLK
    • Tyrosine kinase B lymphocyte specific
    • Tyrosine protein kinase
    • Tyrosine-protein kinase BLK
    see all
  • Function
    Modulator of beta-cells function, acting through the up-regulation of PDX1 and NKX6-1 and consequent stimulation of insulin secretion in response to glucose.
  • Tissue specificity
    Expressed in lymphatic organs, pancreatic islets, Leydig cells, striate ducts of salivary glands and hair follicles.
  • Involvement in disease
    Defects in BLK are a cause of maturity-onset diabetes of the young type 11 (MODY11) [MIM:613375]. MODY11 is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Information by UniProt

References

ab172848 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up