Description

  • Product name

    Recombinant Human BMP1/PCP protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAA AFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQST NGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAV FRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAIS IGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFL KMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIG QRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVW RISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSK LPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDYGHIQSPN YPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHS ESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDE CSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEGCYDLQVGKPLL WDRHCFRLSTHGPEMLGTALRG
    • Amino acids

      1 to 622
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein previously labeled as BMP1.

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BMP 1
    • BMP-1
    • BMP1
    • BMP1_HUMAN
    • Bone morphogenetic protein 1
    • Mammalian tolloid protein
    • mTld
    • OI13
    • PCOLC
    • PCP
    • PCP2
    • Procollagen C endopeptidase
    • Procollagen C proteinase
    • Procollagen C-proteinase
    • TLD
    • Tolloid, Drosophila, homolog of
    see all
  • Function

    Cleaves the C-terminal propeptides of procollagen I, II and III. Induces cartilage and bone formation. May participate in dorsoventral patterning during early development by cleaving chordin (CHRD). Responsible for the proteolytic activation of lysyl oxidase LOX.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Osteogenesis imperfecta 13
  • Sequence similarities

    Belongs to the peptidase M12A family.
    Contains 5 CUB domains.
    Contains 2 EGF-like domains.
  • Post-translational
    modifications

    Proteolytically activated in the trans-Golgi network by furin-like/paired basic proprotein convertases, cleavage is not required for secretion.
  • Cellular localization

    Golgi apparatus, trans-Golgi network. Secreted, extracellular space, extracellular matrix. Co-localizes with POSTN in the Golgi.
  • Information by UniProt

Images

  • ab157967 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up