Description

  • Product name

    Recombinant human BMP2 protein (Fc Chimera)
    See all BMP2 proteins and peptides
  • Biological activity

    Shows the biological function of the BMP-2 moiety and exerts a prolonged circulating half-life caused by the modified Fc domain in vivo. Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 2.0 -3.5μg/ml.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLN STNH AIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQ DMVVEGCGCR
    • Amino acids

      289 to 396
    • Additional sequence information

      The extracellular domain of Human BMP2 (aa 289-396) is fused to the N-terminus of the Fc region of a mutant Human IgG1 (NP_001191.1).

Specifications

Our Abpromise guarantee covers the use of ab214607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Non-lytic: Acts as a long lasting fusion protein which only binds to the receptor. Mutations to the complement (C1q) and FcgR I binding sites of the IgGs Fc fragment render the fusion proteins incapable of antibody directed cytotoxicity (ADCC) and complement directed cytotoxicity (CDC).

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in 50µl sterile water. Add 1X PBS to the desired protein concentration.

General Info

  • Alternative names

    • BDA2
    • BMP-2
    • BMP-2A
    • Bmp2
    • BMP2_HUMAN
    • BMP2A
    • Bone morphogenetic protein 2
    • Bone morphogenetic protein 2A
    see all
  • Function

    Induces cartilage and bone formation.
  • Tissue specificity

    Particularly abundant in lung, spleen and colon and in low but significant levels in heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, ovary and small intestine.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab214607 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214607.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up