Overview

Description

  • Nature

    Recombinant
  • Source

    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCP FPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKV VLKNYQEMVVEGCGCR
    • Molecular weight

      13 kDa
    • Amino acids

      293 to 408
    • Additional sequence information

      Full length mature chain without signal peptide, without propeptide. Source: Genetically modified CHO cells.

Specifications

Our Abpromise guarantee covers the use of ab238298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Alkaline phosphatase activity induced in ATDC-5 cells ED50 ≤15 ng/mL (≥ 6.7 x 10^4 units/mg).

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    <=1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

    12 months from date of receipt when stored at -20°C to -80°C as supplied.
    1 month when stored at 4°C after reconstituting as directed.
    3 months when stored at -20°C to -80°C after reconstituting as directed.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituent: 0.1% Trifluoroacetic acid

    Lyophilized from a sterile (0.2 micron) filtered aqueous solution

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Sterile water at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C, and avoid repeat freeze thaws.

General Info

  • Alternative names

    • zgc:100779
    • BMP 2B
    • BMP 4
    • BMP-2B
    • BMP-4
    • BMP2B
    • BMP2B1
    • BMP4
    • BMP4_HUMAN
    • Bone morphogenetic protein 2B
    • Bone morphogenetic protein 4
    • DVR4
    • MCOPS6
    • MGC100779
    • OFC11
    • zbmp-4
    • ZYME
    see all
  • Function

    Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction.
  • Tissue specificity

    Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines.
  • Involvement in disease

    Defects in BMP4 are the cause of microphthalmia syndromic type 6 (MCOPS6) [MIM:607932]; also known as microphthalmia and pituitary anomalies or microphthalmia with brain and digit developmental anomalies. Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues (anophthalmia). In many cases, microphthalmia/anophthalmia occurs in association with syndromes that include non-ocular abnormalities. MCOPS6 is characterized by microphthalmia/anophthalmia associated with facial, genital, skeletal, neurologic and endocrine anomalies.
    Defects in BMP4 are the cause of non-syndromic orofacial cleft type 11 (OFC11) [MIM:600625]. Non-syndromic orofacial cleft is a common birth defect consisting of cleft lips with or without cleft palate. Cleft lips are associated with cleft palate in two-third of cases. A cleft lip can occur on one or both sides and range in severity from a simple notch in the upper lip to a complete opening in the lip extending into the floor of the nostril and involving the upper gum. OFC11 is an unusual anomaly consisting of a paramedian scar of the upper lip with an appearance suggesting that a typical cleft lip was corrected in utero.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • Alkaline phosphatase activity induced in ATDC-5 cells ED50 ≤15 ng/mL (≥ 6.7 x 10^4 units/mg).

  • Recombinant human BMP4 protein (Active) (ab238298) used at 100 ng.

    4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

References

ab238298 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up