Description

  • Product name

    Recombinant Human BNP protein
    See all BNP proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab151881 is supplied as a 0.2 µm filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGV WKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGL GCKVLRRH
    • Predicted molecular weight

      12 kDa
    • Amino acids

      27 to 134

Specifications

Our Abpromise guarantee covers the use of ab151881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.40
    Constituents: 79% Phosphate Buffer, 0.02% DTT, 0.03% EDTA, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • BNP(1-28)
    • BNP(1-29)
    • BNP(1-30)
    • BNP(1-32)
    • BNP(2-31)
    • BNP(3-29)
    • BNP(3-30)
    • BNP(3-32)
    • BNP(4-27)
    • BNP(4-29)
    • BNP(4-30)
    • BNP(4-31)
    • BNP(4-32)
    • BNP(5-29)
    • BNP(5-31)
    • BNP(5-32)
    • Brain natriuretic peptide 32
    • Brain type natriuretic peptide
    • Gamma brain natriuretic peptide
    • Natriuretic peptide B
    • Natriuretic peptide precursor B
    • natriuretic peptide, brain type
    • Natriuretic peptides B
    • natriuretic protein
    • NPPB
    see all
  • Relevance

    Brain natriuretic peptide (BNP) circulates in blood as a peptide hormone with natriuretic, vasodilatory and renin inhibitory properties. BNP is secreted predominantly by the left ventricular myocytes in response to volume expansion and pressure overload. BNP belongs to a family of structurally similar peptide hormones, which includes atrial natriuretic peptide (ANP), BNP, C type natriuretic peptide (CNP) and urodilatin. These peptides are characterized by a common 17 amino acid ring structure with a disulfide bond between two cystein residues. This ring structure shows high homology between different natriuretic peptides (eleven of the 17 amino acid residues are homologous in the ring of each of the natriuretic peptides). BNP is a 32 amino acid peptide with disulfide bond between the cysteine residues Cys10 and Cys26. In earlier studies it has been demonstrated that BNP concentration in blood increases with the severity of congestive heart failure. Quantitative measurement of BNP in blood provides an objective indicator of congestive heart failure severity.
  • Cellular localization

    Secreted

References

This product has been referenced in:

  • Sinha A  et al. Simultaneous detection of multiple NT-proBNP clinical samples utilizing an aptamer-based sandwich assay on an integrated microfluidic system. Lab Chip 19:1676-1685 (2019). Read more (PubMed: 30942226) »
  • Solomon T  et al. Associations Between Common and Rare Exonic Genetic Variants and Serum Levels of 20 Cardiovascular-Related Proteins: The Tromsø Study. Circ Cardiovasc Genet 9:375-83 (2016). Read more (PubMed: 27329291) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up