Description

  • Product name

    Recombinant Human BOC protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPG GTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHT VGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTI HAASCYS
    • Predicted molecular weight

      43 kDa including tags

Specifications

Our Abpromise guarantee covers the use of ab133012 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BOC cell adhesion associated oncogene regulated
    • Boc homolog
    • Boc homolog (mouse)
    • Brother of CDO
    • Brother of CDON
    • CDON2
    • Cell adhesion associated oncogene regulated 2
    • Protein BOC
    see all
  • Relevance

    Brother of CDO (BOC) interacts with Hedgehog (Hh) via a specific FNIII domain and belongs to the Ihog (interference hedgehog) family of proteins. Zebrafish BOC is expressed predominantly in the developing neural plate and later in the neural tube and developing brain.
  • Cellular localization

    Cell membrane; Single pass type I membrane protein. Note: Enriched at sites of cell-cell contact.

Images

  • 12.5% SDS-PAGE analysis of ab133012 stained with Coomassie Blue.

References

ab133012 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133012.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up