Description

  • Product name

    Recombinant Human BOG protein
  • Purity

    > 95 % SDS-PAGE.
    ab115718 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMASPSKAVIVPGNGGGDVTTHGWYGWVKKE LEKIPGFQCLAKNMPDPITARESIWLPFMETELHCDEKTIIIGHSSGAIA AMRYAETHRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYI VQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKS LLKVPA
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      1 to 186
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115718 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as RBBP9. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • B5T overexpressed gene protein
    • B5T-overexpressed gene protein
    • BOG
    • Bog protein
    • MGC9236
    • OTTHUMP00000030360
    • Protein BOG
    • Putative hydrolase RBBP9
    • RBBP 10
    • RBBP 9
    • RBBP-10
    • RBBP-9
    • RBBP10
    • RBBP9
    • RBBP9_HUMAN
    • Retinoblastoma binding protein 10
    • Retinoblastoma binding protein 9
    • Retinoblastoma-binding protein 10
    • Retinoblastoma-binding protein 9
    • Retinoma binding protein 9
    see all
  • Function

    May play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.
  • Tissue specificity

    Widely expressed. Expressed at higher levels in tumor tissues than in normal tissues.
  • Sequence similarities

    Belongs to the RBBP9 family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab115718 (3µg).

References

ab115718 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115718.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up