Recombinant Human Bone marrow stromal cell antigen 1 protein (ab157975)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGR CAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHS IPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDS GLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAY PIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRL KDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQ RAGLIIPLFLVLASRTQL
    • Amino acids
      1 to 318
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157975 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP ribosyl cyclase 2
    • ADP-ribosyl cyclase 2
    • ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
    • Bone marrow stromal antigen 1
    • Bone marrow stromal cell antigen 1
    • BST 1
    • BST-1
    • BST1
    • BST1_HUMAN
    • cADPr hydrolase 2
    • CD157
    • CD157 antigen
    • Cyclic ADP ribose hydrolase 2
    • Cyclic ADP-ribose hydrolase 2
    • NAD(+) nucleosidase
    • OTTHUMP00000217617
    see all
  • Function
    Synthesizes the second messagers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger that elicits calcium release from intracellular stores. May be involved in pre-B-cell growth.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the ADP-ribosyl cyclase family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab157975 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157975 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157975.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up