Description

  • Product name

    Recombinant Human BOULE/BOLL protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPL SLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY
    • Amino acids

      185 to 283
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153500 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as BOULE

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Bol
    • Bol (Drosophila boule homolog) like
    • Bol boule like
    • Bol, boule like (Drosophila)
    • bol, boule-like (Drosophila)
    • Boll
    • BOLL_HUMAN
    • BOULE
    • Boule like
    • BOULE, Drosophila, homolog of
    • Protein boule like
    • Protein boule-like
    • Putative uncharacterized protein BOLL
    see all
  • Function

    Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation.
  • Tissue specificity

    Testis specific. Not expressed in early embryos, primordial germ cells and spermatogonial cells. First expressed in the cytoplasm of spermatocytes and then persists through meiosis.
  • Sequence similarities

    Belongs to the RRM DAZ family.
    Contains 1 DAZ-like domain.
    Contains 1 RRM (RNA recognition motif) domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab153500 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153500 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153500.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up