Description

  • Product name

    Recombinant Human BPIL1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAWASRLGLLLALLLPVVGASTPGTVVRLNKAALSYVSEIGKAPLQRALQ VTVPHFLDWSGEALQPTRIRILNVHVPRLHLKFIAGFGVRLLAAANFTFK VFRAPEPLELTLPVELLADTRVTQSSIRTPVVSISACSLFSGHANEFDGS NSTSHALLVLVQKHIKAVLSNKLCLSISNLVQGVNVHLGTLIGLNPVGPE SQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDATPFVLPRHVGT EGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRL IPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPFVEVLATASNS AFQSLFSLDVVVNLRLQLSVSKVKLQGTTSVLGDVQLTVASSNVGFIDTD QVRTLMGTVFEKPLLDHLNALLAMGIALPGVVNLHYVAPEIFVYEGYVVI SSGLFYQS
    • Amino acids

      1 to 458
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Bactericidal permeability increasing protein like 1
    • Bactericidal/permeability-increasing protein-like 1
    • BPI fold-containing family B member 2
    • BPI-like 1
    • BPIB2_HUMAN
    • Bpifb2
    • C20orf184
    • dJ726C3.2
    • Long palate
    • Long palate lung and nasal epithelium carcinoma associated 2
    • Long palate lung and nasal epithelium carcinoma associated protein 2
    • LPLUNC2
    • lung and nasal epithelium carcinoma-associated protein 2
    • OTTHUMP00000030612
    • RYSR
    see all
  • Tissue specificity

    Highly expressed in tonsils, especially in hypertrophic tonsils. Detected at very low levels in fetal liver.
  • Sequence similarities

    Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab164262 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up