Description

  • Product name

    Recombinant Human BPTF / FALZ protein (Tagged)
  • Purity

    >= 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      CPPVTPAPPAPPAPPPSPPPPPAVQHTGLLSTPTLPAASQKRKREEEKDS SSKSKKKKMISTTSKETKKDTKLYCICKTPYDESKFYIGCDRCQNWYHGR CVGILQSEAELI
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      2796 to 2907
    • Tags

      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab176966 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names

    • BPTF
    • BPTF_HUMAN
    • Bromodomain and PHD finger containing transcription factor
    • Bromodomain and PHD finger-containing transcription factor
    • Bromodomain PHD finger transcription factor
    • FAC 1
    • fac1
    • FALZ
    • Fetal Alz 50 clone 1 protein
    • Fetal Alz 50 reactive clone 1
    • Fetal Alz-50 clone 1 protein
    • Fetal Alzheimer antigen
    • Nucleosome remodeling factor
    • Nucleosome remodeling factor subunit BPTF
    • Nucleosome remodeling factor, large subunit
    • Nucleosome-remodeling factor subunit BPTF
    • NURF 301
    • NURF301
    see all
  • Function

    Histone-binding component of NURF (nucleosome-remodeling factor), a complex which catalyzes ATP-dependent nucleosome sliding and facilitates transcription of chromatin. Specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes. May also regulate transcription through direct binding to DNA or transcription factors.
  • Tissue specificity

    Ubiquitously expressed, with highest levels in testis. Present in kidney, liver and brain. In the brain, highest levels are found in motor cortex (at protein level).
  • Sequence similarities

    Belongs to the PBTF family.
    Contains 1 bromo domain.
    Contains 1 DDT domain.
    Contains 2 PHD-type zinc fingers.
  • Developmental stage

    Abundantly expressed in the fetal brain. Present throughout the gray and white matter of the developing spinal cord at 18-22 gestational weeks. Expressed at low levels in adult brain and spinal cord and reexpressed in neurodegenerative diseases (at protein level).
  • Domain

    The second PHD-type zinc finger mediates binding to histone H3K4Me3. Has specificity for trimethyllysine; introducing a mutation in the Tyr-2876 residue can induce binding to dimethyllysine.
  • Post-translational
    modifications

    Phosphorylation enhances DNA-binding.
    Highly susceptible to proteolysis.
  • Cellular localization

    Cytoplasm. Nucleus. In brains of Alzheimer disease patients, present in a subset of amyloid-containing plaques.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab176966
    Lane 1: Markers:
    Lane 2: ab176966 (2 μg)
    Lane 3: ab176966 (4 μg)
    Lane 4: ab176966 (8 μg)

References

ab176966 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176966.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up