Description

  • Product name

    Recombinant human BRAF protein
    See all BRAF proteins and peptides
  • Biological activity

    The specific activity of ab204212 was determined to be 220 nmol/min/mg.

  • Purity

    > 70 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSS SSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDV AVKMLNVTAPTPQQLQAFKNEVGVLRVLRKTRHVNILLFMGYSTKPQLAI VTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDL KSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRM QDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPD LSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRS ASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
    • Predicted molecular weight

      69 kDa including tags
    • Amino acids

      381 to 766
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      Insertion VLR at amino acids 506 to 507; NM_004333.

Specifications

Our Abpromise guarantee covers the use of ab204212 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • FLJ95109
    • 94 kDa B raf protein
    • B raf
    • B raf 1
    • B Raf proto oncogene serine threonine protein kinase
    • B Raf proto oncogene, serine/threonine kinase
    • B RAF1
    • B-Raf proto-oncogene serine/threonine-protein kinase (p94)
    • BRAF
    • BRAF 1
    • BRAF_HUMAN
    • BRAF1
    • cRmil
    • MGC126806
    • MGC138284
    • Murine sarcoma viral (v-raf) oncogene homolog B1
    • Murine sarcoma viral v raf oncogene homolog B1
    • NS7
    • Oncogen BRAF
    • oncogene BRAF1
    • p94
    • Proto-oncogene B-Raf
    • Proto-oncogene c-Rmil
    • RAFB 1
    • RAFB1
    • RMIL
    • Serine/threonine-protein kinase B-raf
    • v raf murine sarcoma viral oncogene homolog B
    • v raf murine sarcoma viral oncogene homolog B1
    • v-Raf murine sarcoma viral oncogene homolog B1
    see all
  • Function

    Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May play a role in the postsynaptic responses of hippocampal neuron.
  • Tissue specificity

    Brain and testis.
  • Involvement in disease

    Note=Defects in BRAF are found in a wide range of cancers.
    Defects in BRAF may be a cause of colorectal cancer (CRC) [MIM:114500].
    Defects in BRAF are involved in lung cancer (LNCR) [MIM:211980].
    Defects in BRAF are involved in non-Hodgkin lymphoma (NHL) [MIM:605027]. NHL is a cancer that starts in cells of the lymph system, which is part of the body's immune system. NHLs can occur at any age and are often marked by enlarged lymph nodes, fever and weight loss.
    Defects in BRAF are a cause of cardiofaciocutaneous syndrome (CFC syndrome) [MIM:115150]; also known as cardio-facio-cutaneous syndrome. CFC syndrome is characterized by a distinctive facial appearance, heart defects and mental retardation. Heart defects include pulmonic stenosis, atrial septal defects and hypertrophic cardiomyopathy. Some affected individuals present with ectodermal abnormalities such as sparse, friable hair, hyperkeratotic skin lesions and a generalized ichthyosis-like condition. Typical facial features are similar to Noonan syndrome. They include high forehead with bitemporal constriction, hypoplastic supraorbital ridges, downslanting palpebral fissures, a depressed nasal bridge, and posteriorly angulated ears with prominent helices. The inheritance of CFC syndrome is autosomal dominant.
    Defects in BRAF are the cause of Noonan syndrome type 7 (NS7) [MIM:613706]. Noonan syndrome is a disorder characterized by facial dysmorphic features such as hypertelorism, a downward eyeslant and low-set posteriorly rotated ears. Other features can include short stature, a short neck with webbing or redundancy of skin, cardiac anomalies, deafness, motor delay and variable intellectual deficits.
    Defects in BRAF are the cause of LEOPARD syndrome type 3 (LEOPARD3) [MIM:613707]. LEOPARD3 is a disorder characterized by lentigines, electrocardiographic conduction abnormalities, ocular hypertelorism, pulmonic stenosis, abnormalities of genitalia, retardation of growth, and sensorineural deafness.
    Note=A chromosomal aberration involving BRAF is found in pilocytic astrocytomas. A tandem duplication of 2 Mb at 7q34 leads to the expression of a KIAA1549-BRAF fusion protein with a constitutive kinase activity and inducing cell transformation.
  • Sequence similarities

    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. RAF subfamily.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 protein kinase domain.
    Contains 1 RBD (Ras-binding) domain.
  • Cellular localization

    Nucleus. Cytoplasm. Cell membrane. Colocalizes with RGS14 and RAF1 in both the cytoplasm and membranes.
  • Information by UniProt

Images

  • The purity of ab204212 was determined to be >70% by densitometry.
    Approximate MWt: 69 kDa.

  • Kinase assay showing the specific activity of ab204212 as 220 nmol/min/mg.

References

ab204212 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204212.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up