Overview

  • Product name

    Recombinant Human BRAG2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MLERKYGGRLVTRHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVL SNMRMQFSFEGPEKVHSSYFEGKQVSVTNDGSQLGALVSPECGDLSEPTT LKSPAPSSDFADAITELEDAFSRQVKSLAESIDDALNCRSLHTEEAPALD AARARDTEPQTALHGMDHRKLDEMTASYSDVTLYIDEEELSPPLPLSQAG DRPSSTESDLRLRAGGAAPDYWALAHKEDKADTDTSCRSTPSLERQEQRL RVEHLPLLTIEPPSDSSVDLSDRSERGSLKRQSAYERSLGGQQGSPKHGP HSGAPKSLPREEPELRPRPPRPLDSHLAINGSANRQSKSESDYSDGDNDS INSTSNSNDTINCSSESSSRDSLREQTLSKQTYHKEARNSWDSPAFSNDV IRKRHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQ MIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQ KVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVK PERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNEDHVSQV QKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLG LHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYP NGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKHRI ESELEKQKGVVRPSMSQCSSLKKESGNGTLSRACLDDSYASGEGLKRSAL SSSLRDLSEAGVHH
    • Amino acids

      1 to 814
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as IQSEC1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ADP-ribosylation factors guanine nucleotide-exchange protein 100
    • ADP-ribosylation factors guanine nucleotide-exchange protein 2
    • ARF GEP100
    • ARFGEP100
    • BRAG2
    • Brefeldin A resistant ARF GEF2
    • Brefeldin-resistant Arf-GEF 2 protein
    • GEP100
    • IQ motif and Sec7 domain 1
    • IQ motif and SEC7 domain-containing protein 1
    • IQEC1_HUMAN
    • Iqsec1
    • Kiaa0763
    see all
  • Function

    In addition to accelerate GTP gamma S binding by ARFs of all three classes, it appears to function preferentially as a guanine nucleotide exchange protein for ARF6, mediating internalisation of beta-1 integrin.
  • Tissue specificity

    Expressed in brain, ovary, heart, lung, liver, kidney and leukocytes. Moderate expression was also detected in lung, skeletal muscle, placenta, small intestine, pancreas, spleen and testis.
  • Sequence similarities

    Belongs to the BRAG family.
    Contains 1 IQ domain.
    Contains 1 PH domain.
    Contains 1 SEC7 domain.
  • Cellular localization

    Cytoplasm. Nucleus. At steady state, may be preferentially cytosolic.
  • Information by UniProt

Images

  • ab160717 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160717 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up