Overview

  • Product name

    Recombinant Human BRAT1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDPECAQLLPALCAVLVDPGQPVADDTCLEKLLDWFKTVTEGESSVVLLQ EHPCLVELLSHVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLP GLFGEPGPLGRATWAVPTVRSGWIQGLRSLAQHPSALRFLADHGAVDTIF SLQGDSSLFVASAASQLLVHVLALSMRGGAEGQPCLPGGDWPACAQKIMD HVEESLCSAATPKVTQALNVLTTTFGRCQSPWTEALWVRLSPRVACLLER DPIPAAHSFVDLLLCVARSPVFSSSDGSLWETVARALSCLGPTHMGPLAL GILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGLLDGTADDATT VDTLLASKSSCAGLLCRTLAHLEELQPLPQRPSPWPQASLLGATVTVLRL CDGSAAPASSVGGHLCGTLAGCVRVQRAALDFLGTLSQGTGPQELVTQAL AVLLECLESPGSSPTVLKKAFQATLRWLLSSPKTPGCSDLGPLIPQFLRE LFPVLQKRLCHPCWEVRDSALEFLTQLSRHWGGQADFRCALLASEVPQLA LQLLQDPESYVRASAVTAMGQLSSQGLHAPTSPEHAEARQSLFLELLHIL SVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQFVATVLQAASRDLDWEV RAQGLELALVFLGQTLGPPRTHCPYAVALPEVAPAQPLTEALRALCHVGL FDFAFCALFDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEA TLPRWRAGEQAQPPGDQEPEAVLAMLRSLDLEGLRSTLAESSDHVEKSPQ SLLQDMLATGGFLQGDEADCY
    • Molecular weight

      114 kDa including tags
    • Amino acids

      1 to 821

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132414 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.

     This product was previously labelled as BAAT1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BAAT 1
    • BAAT1
    • BRAT 1
    • brat1
    • BRAT1_HUMAN
    • BRCA1-associated ATM activator 1
    • BRCA1-associated protein required for ATM activation protein 1
    • BRCA1-associated protein required for ATM activation-1
    • C7orf27
    • chromosome 7 open reading frame 27
    • HEAT repeat containing protein C7orf27
    • MGC22916
    • RMFSL
    see all
  • Function

    Required for activation of ATM following ionizing radiation. May act by regulating dephosphorylation of ATM.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Contains 2 HEAT repeats.
  • Cellular localization

    Nucleus. Present at double strand breaks (DSBs) following ionizing radiation treatment.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132414, stained with Coomassie Blue.

References

ab132414 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132414.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up