Recombinant Human BRD1 protein (Tagged) (ab176940)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKH PMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRL RDQGGVVLRQARREVDSIGLEEASG
    • Molecular weight
      41 kDa including tags
    • Amino acids
      556 to 680
    • Tags
      proprietary tag N-Terminus
    • Additional sequence information
      Bromodomain.

Specifications

Our Abpromise guarantee covers the use of ab176940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

    Information available upon request.

General Info

  • Alternative names
    • BR140-like protein
    • BRD1
    • BRD1_HUMAN
    • BRL
    • Bromodomain and PHD finger-containing protein 2
    • Bromodomain containing 1
    • Bromodomain-containing protein 1
    • BRPF1
    • BRPF2
    • DKFZp686F0325
    see all
  • Function
    Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity.
  • Tissue specificity
    Highly expressed in testis.
  • Sequence similarities
    Contains 1 bromo domain.
    Contains 1 PHD-type zinc finger.
    Contains 1 PWWP domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab176940.

    Lane 1; 2 µg

    Lane 2; 5 µg

    Lane 3; 10 µg

References

ab176940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up