Description

  • Product name

    Recombinant human BRD2 protein
    See all BRD2 proteins and peptides
  • Biological activity

    ab196099 is incubated with biotinylated acetyl-histone peptide substrate in BRD assay buffer in a 10 µl reaction for 1 hour at RT.

  • Purity

    >= 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYH KIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVL MAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQ VPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGPPLLAV TAAPPAQPLAKKKGVKRKADTTTPTPTAILAPGSPASPPGSLEPKAARLP PMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKELLSKK HAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEF AADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLE
    • Predicted molecular weight

      71 kDa including tags
    • Amino acids

      65 to 459
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      Bromodomains 1 and 2 (NM_005104).

Specifications

Our Abpromise guarantee covers the use of ab196099 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 1.74% Sodium chloride, 10% Glycerol, 0.03% EDTA, 0.03% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • BRD 2
    • Brd2
    • BRD2_HUMAN
    • Bromodomain containing 2
    • Bromodomain-containing protein 2
    • D6S113E
    • DKFZp686N0336
    • Female sterile homeotic related gene 1
    • Female sterile homeotic related gene 1, mouse, homolog of
    • FLJ31942
    • FSH
    • FSRG1
    • KIAA9001
    • NAT
    • O27.1.1
    • Really interesting new gene 3 protein
    • RING3
    • RING3 PROTEIN
    • RNF3
    see all
  • Function

    May play a role in spermatogenesis or folliculogenesis.
  • Sequence similarities

    Contains 2 bromo domains.
    Contains 1 ET domain.
  • Domain

    One bromodomain is sufficient for a partial interaction with histone H4 acetylated at 'Lys-13'.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab196099 binding to biotinylated acetyl-histone peptide substrate.

  • 4-20% SDS-PAGE analysis of 0.5 µg ab196099 followed by Coomassie staining.

References

ab196099 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196099.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up