Description

  • Product name

    Recombinant human BRD2 protein
    See all BRD2 proteins and peptides
  • Biological activity

    BRD2 is incubated with biotinylated acetyl-histone peptide substrate in BRD assay buffer in a 10 µL reaction for 1 hour at RT. 

  • Purity

    >= 98 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYH KIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVL MAQTLEKIFLQKVASMPQEEQEL
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      65 to 187
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Bromodomain 1 (NM_005104).

Specifications

Our Abpromise guarantee covers the use of ab196109 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • BRD 2
    • Brd2
    • BRD2_HUMAN
    • Bromodomain containing 2
    • Bromodomain-containing protein 2
    • D6S113E
    • DKFZp686N0336
    • Female sterile homeotic related gene 1
    • Female sterile homeotic related gene 1, mouse, homolog of
    • FLJ31942
    • FSH
    • FSRG1
    • KIAA9001
    • NAT
    • O27.1.1
    • Really interesting new gene 3 protein
    • RING3
    • RING3 PROTEIN
    • RNF3
    see all
  • Function

    May play a role in spermatogenesis or folliculogenesis.
  • Sequence similarities

    Contains 2 bromo domains.
    Contains 1 ET domain.
  • Domain

    One bromodomain is sufficient for a partial interaction with histone H4 acetylated at 'Lys-13'.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 20 µg ab196109 with Coomassie staining.

  • ab196109 binding to biotinylated acetyl-histone peptide substrate.

References

ab196109 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196109.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up