Description

  • Product name

    Recombinant human BRD3 protein
    See all BRD3 proteins and peptides
  • Purity

    >= 37 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLP DYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDD IVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKPAAGAQSAGTQQV AAVSSVSPATPFQSVPPTVSQTPVIAATPVPTITANVTSVPVPPAAAPPP PATPIVPVVPPTPPVVKKKGVKRKADTTTPTTSAITASRSESPPPLSDPK QAKVVARRESGGRPIKPPKKDLEDGEVPQHAGKKGKLSEHLRYCDSILRE MLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYP DAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKM
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      29 to 417
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Corresponding to bromodomains 1 and 2.

Specifications

Our Abpromise guarantee covers the use of ab196096 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.2
    Constituents: 0.95% HEPES, 1.68% Sodium chloride, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • BRD 3
    • Brd3
    • BRD3_HUMAN
    • Bromodomain containing 3
    • Bromodomain containing protein 3
    • Bromodomain-containing protein 3
    • KIAA0043
    • Open reading frame X
    • ORFX
    • RING3 like gene
    • RING3-like protein
    • RING3L
    see all
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Note=A chromosomal aberration involving BRD3 is found in a rare, aggressive, and lethal carcinoma arising in midline organs of young people. Translocation t(15;9)(q14;q34) with NUT which produces a BRD3-NUT fusion protein.
  • Sequence similarities

    Contains 2 bromo domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • SDS PAGE analysis of ab196096.

  • BRD3 protein is incubated with biotinylated acetyl-histone peptide substrate in BRD assay buffer in a 10 µl reaction for 1 hour at RT. Ni acceptor beads are added, followed by Streptavidin-conjugated donor beads. After 1 hour incubation at RT, Alphacounts are measured.

References

ab196096 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196096.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up