Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPSKPGRKTNQLQYMQNVVV KTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWS ASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL LPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPATPFQSVPPTVSQTPVIA ATPVPTITANVTSVPVPPAAAPPPPATPIVPVVPPTPPVVKKKGVKRKAD TTTPTTSAITASRSESPPPLSDPKQAKVVARRESGGRPIKPPKKDLEDGE VPQHAGKKGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHD YHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEV VAMARKLQDVFEMRFAKMPD
    • Molecular weight

      70 kDa including tags
    • Amino acids

      29 to 417
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      Bromodomains 1 and 2 (NM_007371).

Specifications

Our Abpromise guarantee covers the use of ab196112 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    BRD3 protein is incubated with biotinylated acetyl-histone peptide substrate in BRD assay buffer in a 10 µl reaction for 30 min at RT.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    >= 77 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • BRD 3
    • Brd3
    • BRD3_HUMAN
    • Bromodomain containing 3
    • Bromodomain containing protein 3
    • Bromodomain-containing protein 3
    • KIAA0043
    • Open reading frame X
    • ORFX
    • RING3 like gene
    • RING3-like protein
    • RING3L
    see all
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Note=A chromosomal aberration involving BRD3 is found in a rare, aggressive, and lethal carcinoma arising in midline organs of young people. Translocation t(15;9)(q14;q34) with NUT which produces a BRD3-NUT fusion protein.
  • Sequence similarities

    Contains 2 bromo domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab196112 binding biotinylated acetyl-histone peptide substrate.

  • 4-20% SDS-PAGE analysis of 2 µg ab196112 with Coomassie staining.

References

ab196112 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196112.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up